>PF14_0142(query protein 1; example of Secretory Protein of Malaria Parasite)
MALEIDIDNVISKLIEVRGTRPGKNVNLTENEIKILCLSSREIFLNQPILLELEAPIKIC GDIHGQFYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR GNHECASINRIYGFYDECKRRYSVKLWKTFIDCFNCLPVAAIIDEKIFCMHGGLSPELNN MEQIRKITRPTDVPDNGLLCDLLWSDPEKEINGWGENDRGVSFTFGQDVVHNFLRKHELD LICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPVEKK KAAN
>MAL13P1.164 (query protein 2; example of non Secretory Protein of Malaria Parasite)
MLKSKCIFLNSFTKSDKLKHTFERLNLMMEKRNMNNLLYNKAVECHIYIRRDRDTKETNK KLNNMYNKYSCKCNITNKCSNKNKVYNIYKRQNNLVDNKDKFFCIFRQNFAIGIFERKKP HMNIGTIGHVDHGKTTLTAAITKVCSDLNRGVFKSYEEIDKTPEEQKRGITINATHVEYE TEKRHYSHIDCPGHLDYIKNMITGTSQMDGSILVVSAYDGLMPQTKEHVLLSRQIGIEKM IVYLNKIDMCEDQELVDLVELEIRELLSFHKYDGDNIPFIKGSALKALNGDQSEYGVPSI LKLLDACDNYIEEPKRKTDLPFLMSIDDVLQISGKGTVATGKVEQGTLKLNDQVEILGIK EKSIKTVITGIEMFRKILDTAQAGDQIGIMLKNVKRNDITRGMVVTKAPNIKTFKKFESD IYVLKNEEGGRKNPFSSYYRPQAYIRTADVNCAVILNEDTQVANPGDNVKCVIELMYPLA LTYGLRFSLREGGKTVASGVITKLL
NOTE:
(1) For each submission, the number of proteins is limited at 10 or less;
(2) Each protein sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description.
Close