>Q60736
MITWSFIDLWRTSHSTLFQMTLATVLMAPVLGDCGPPPLLPFASPTNQLYESTTFPSGTVLKYTCHHGFK
RVNSSHLSCDENGSWVYSTFCARKRCKNPGELVNGKVEIPSDLLVGSIIEFSCSKGYLLIGSATSRCEVQ
GKGVDWSDSLPECVIATCEPPPPISNGKHSGRDDDLYTFGSVVIYNCDPTFTLLGNASIVCTVVNRTVGV
WRPHPPACQKIVCHRPQIPKGYLAPGFRQFYAYRDALEIRCKKGFILRGSSVIHCEANGEWFPSIPTCEP
NGCTNIPDISYASWEGYKFPLRNFEVFEIGAKLKYQCKPGYRASLNDPQTVTCQENLTWSSTNGCERICC
PTPDMEKIKIVSERRDFTGTCIYAYGDYVFYICNEGSYPMSTDGRSSCQADGKWDPAIPSCQADSGLQNR
LALFTFPNISETNVTNKTYLFGHEENSTEHAMKGVCLKPMVINGNLSVERVIYAELENITIQCDPGYTIV
GSPNIICSNRTWYPEVPSCQMEVLEDCRIVSRGAQLLHCLSSPEDVHRALKVYKLFLEIERLEHQKEKWI
QLHRKPQSMKINRSFRLCN
>Q60680
MERPPGLRPGAGGPWEMRERLGTGGFGNVSLYQHRELDLKIAIKSCRLELSSKNRERWCHEIQIMKKLDH
ANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKI
IHRDLKPENIVLQDVGGKTIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTM
VFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMESWLQLML
NWDPQQRGGPIDLTLKQPRCFALMDHILNLKIVHILNMTSAKIISFLLPCDESLHSLQSRIERETGINTG
SQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFRKSIQLD
LERYSEQMTYGISSEKMLKAWKEMEEKAIHYSEVGVIGYLEDQIMSLHTEIMELQKSPYGRRQGDLMESL
EQRAIDLYKQLKHRPPDHLYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALS
NIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGTVTPPVSAWLPPTLADREHPLTCVVTP
QDGETLAQMIEENLNCLGHLSTIIREANEDQSSSLMSLDWSWLAE
>Q60714
MRAPGAGTASVASLALLWFLGLPWTWSAAAAFCVYVGGGGWRFLRIVCKTARRDLFGLSVLIRVRLELRR
HRRAGDTIPCIFQAVARRQPERLALVDASSGICWTFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPE
FVGLWLGLAKAGVVAALLNVNLRREPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGKSLLKFCSGDLGP
ESILPDTQLLDPMLAEAPTTPLAQAPGKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMR
AADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLRQPVR
DVEQRHRVRLAVGNGLRPAIWEEFTQRFGVPQIGEFYGATECNCSIANMDGKVGSCGFNSRILTHVYPIR
LVKVNEDTMEPLRDSEGLCIPCQPGEPGLLVGQINQQDPLRRFDGYVSDSATNKKIAHSVFRKGDSAYLS
GDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADPH
SQLDPNSMYQELQKVLASYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGRYVP
LDERVHARICAGDFSL
NOTE:
Each protein sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description.
Close