>Q9Z297 (example of 1 subcellular locations)
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDN
LSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEE
EIIKLAPPPKKA
>Q924M7 (example of 1 subcellular locations)
MASPRVFPLSCVVQQYAWGKVGSKSEVACLLASSDPLAQISEDKPYAELWMGTHPRGDA
KILDNRISQKTLGQWIAENPDCLGSKVKNTFNGKLPFLFKVLSVDTALSIQAHPNKELA
EKLHLQAPEHYPDANHKPEMAIALTSFQGLCGFRPVEEIVTFMKKVPEFQLLIGDDATA
QLKESVGGDTEAMASALRNCFSHLMKSEKKVVVEQLNLLVKRISQQVFDGNNMEDIYGK
LLLQLHQQHPGDIGCFAIYFLNLLTLKPGEAMFLDANVPHAYLKGDCVECMACSDNTVR
AGLTPKFIDVPTLCEMLNYTPSPSNNRLFAPAQSQDDPYLSIYDPPVPDFTVMKMEVPS
SVTEYKVSTLDSASILLMVQGTVTAIIPSAHAEIPLYRGGVLFIAANESVLLKITVPKD
LLIFRACCLL
>Q8R0P4 (example of 1 subcellular locations)
MASPKIASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVKEVAE
KGVQTLVIGRGMSEALKVPPSTVEYLEKQGIDVRVLQTEQAVKEYNALVAQGVRVGGVF
HSTC
>Q62875 (example of 2 subcellular locations)
MGDDDTPVCLSVASCKGVSCWLDKLLLWALTLSITLRNTAVDCRRVDRNGLLSPNLNSS
MSVVRMGQNVSLSCSSKNTSIDITYSLFLGKRYLESKRRRGGAVDFHLRISNANESGPY
KCKVNDSNSSKYSQNFNFTIIQDESCSSCLLSLLLPGVLLGLILPGLAFLIYLKYKKGC
TGKTLKENESKGSGDAPTQGELYANICETQKGSEQLQEIHYTTPVFKEVAPTEQEGLED
RKDDYIYSELTY
>Q9WVT0 (example of 2 subcellular locations)
MKSSRTVTLYFVLIVICSSEATWSRPAEPIVHPLILQEHELAGEELLRPKRAVAVGGPV
AEEYTVDVEISFENVSFLESIRAHLNSLRFPVQGNGTDILSMAMTTVCTPTGNDLLCFC
EKGYQWPEERCLSSLTCQEHDSALPGRYCNCLKGLPPQGPFCQLPETYITLKIKVRLNI
GFQEDLENTSSALYRSYKTDLERAFRAGYRTLPGFRSVTVTQFTKGSVVVDYIVEVASA
PLPGSIHKANEQVIQNLNQTYKMDYNSFQGTPSNETKFTVTPEFIFEGDNVTLECESEF
VSSNTSWFYGEKRSDIQNSDKFSIHTSIINNISLVTRLTIFNFTQHDAGLYGCNVTLDI
FEYGTVRKLDVTPIRILAKEERKVVCDNNPISLNCCSENIANWSRIEWKQEGKINIEGT
PETDLESSCSTYTLKADGTQCPSGSSGTTVIYTCEFVSVYGAKGSKNIAVTFTSVANLT
ITPDPISVSEGQSFSITCLSDVSSFDEVYWNTSAGIKIHPRFYTMRRYRDGAESVLTVK
TSTREWNGTYHCIFRYKNSYSIATKDVTVHPLPLESDIMMDPLEASGLCTSSHQFKCCI
EENDGEEYIVTFHVDSSSFPAEREVIGKQACYTYSLPGKLPSRCPKDIDVFCHFTNAAN
SSVRSPSMKLTLVPGKNITCQDPIIGIGEPGKVIQKLCQFAGVSRSPGQTIGGTVTYKC
VGSQWKEETRACISAPINGLLQLAKALIKSPSQDQKLPKYLRDLSVSTGKEEQDIRSSP
GSLGAIISILDLLSTVPTQVNSEMMRDILATINVILDKSTLNSWEKLLQQQSNQSSQFL
QSVERFSKALELGDSTPPFLFHPNVQMKSMVIKRGHAQMYQQKFVFTDSDLWGDVAIDE
CQLGSLQPDSSIVTVAFPTLKAILAQDGQRKTPSNSLVMTTTVSHNIVKPFRISMTFKN
NHRSGGKPQCVFWNFSLANNTGGWDSSGCTVEDDGRDNRDRVFCKCNHLTSFSILMSPD
SPDPGSLLKILLDIISYIGLGFSIVSLAACLVVEAMVWKSVTKNRTSYMRHICIVNIAL
CLLIADIWFIVAGAIHDGHYPLNETACVAATFFIHFFYLSVFFWMLTLGLMLFYRLIFI
LHDASKSTQKAIAFSLGYGCPLIISSITVGVTQPQEVYMRKNACWLNWEDTRALLAFAI
PALIIVVVNVSITVVVITKILRPSVGDKPGKQEKSSLFQISKSIGVLTPLLGLTWGFGL
ATVIQGSNAVFHIIFTLLNAFQGLFILLFGCLWDQKVQEALLHKFSLSRWSSQHSKSTS
LGSSTPVFSMSSPISRRFNNLFGKTGTYNVSTPETTSSSVENSSSAYSLLN
>Q5RFR2 (example of 2 subcellular locations)
MAWRAAASTCAALLILRWALTTAGDLKVEMMAGGTQITPLNDNVTIFCNVFYSQPLNIT
SMGITWFRKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLQLPGIQLEEAG
EYRCEVVVTPLKAQGTVQLRVVASPASRLFLDQVGVKENEGKYMCESSGFYPEAINIIW
KKQTLKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVWHESLH
TPLRNNFTLTAARHSLSETEKTDIFSIHWWPISFIGVGLVLLIVLIPWKKMCNKSSSAY
TPLKCIMKHWNSFDTQTLKKEHLVFFCTWAWPSYQLQDGEAWPPEGSVNINTIQQLDVF
CRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSPKSEKQTPREH
SDAVPDAPILPVSPIWESPPATTSITPVLPSQPPTLLLPLQ
>Q8CBC4 (example of 3 subcellular locations)
MDDSDPPTYSLQIEPQDGCHPGDSVERRVTRLPSVSDENENQLAGDGPAGLTTSEGAMG
RATVSEQDSLNNNESFPSSCEAAPTENAENTPSEGPKDDPPSLGQDQKLPAKRSPRAKK
SSPKSAPPGDAVPVMQTQNATSQAAGEEEAAGVNANDPPKAPALQPLFSLIRGEVAQMD
SRALPLFLHQVAETYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKAVQPR
TVTPLRNSEKGFNGEDFEQLAKICTTHQDPLLSKLKTAPVEPSPERKSLARAIMSEEAV
GTEAAAKEPEIETCPSTDPSGDRHEEEPQESSPGCHQMEWQTASPELPGTAGKDHTEEL
PSSTNATLDLHTQSLETAGSRSGPAAASNACKDSSCVPAPPTEDHCGVARDPKVAPPSE
SVAEQKLSTGDDGALPGLISEGKYSQAHRKELCLPLQDAFEALPRDQPHSSEVAEPRQP
DVTASDGKSAQSQAGLETGPESALCGDRKACDVSTLCLEVCMAPEERRDSEDRVSKETE
DYLHSLLERCLKDAEDSLSYEDIQDDDSDLLQDLSPEEASYSLQEDLPPDESTLSLDDL
AKKIEIAEAIPAEGLVSILKKRNDTVGSHPAQMQQKPAKRRVRFQEIDDNLEQDEVGGG
SCILLILLCIATVFLSVGGTALYCTLGNIESPVCTDFADNVDFYYTKLLQGVAGLKHWV
YLS
>A8XNX8 (example of 3 subcellular locations)
MVICHSCTTFCILLVIDLVPCRIVGMENVENRVMFSLLDRSPQTNDTGPKPEKFEIAKG
KFKVLEENSIGADTVSHLPTTREEHVSAVVPMPNFDPHRLEKALRTKGSIDGTEEALYR
SLLDHTVYEKDVRPCIHHSQPTNVTFGFLLNQIVEMDERNQALTTRSWLNINWMDPRLS
WNESLWSDIKAIYIPHARIWKPDIILVNNAIREYYASLVSTDVMVTSDGNVTWLFSALF
RSSCPIRVRYYPFDDQQCDLKFASWSHDITEINLGLNTDKGDLSSYMNNSEFDLVDMTA
VREVVRFPSDTNSDWPTIVIRIHMHRRPLFYVFNHIVPCVLISSMAVLGFLMPPETGEK
INMIITTLLSMGVYLQSITESIPPTSEGVPLIGMYYVSSLLMVCLATCVNVITLNMHRN
GAANQGRHVPAWMQKWILGYLATFMRMSIREPDSIALLKASQSKKSTIRRSSILRDLKR
VKNMSNVRAKSKEQNANRECECMDPLVHIYAESIMTSLVSDPKPMNGSTIREDFASEST
FLGRVVSDGIMPRISASSNSVLTEFETRFRRILKRVYRSLQQHEIREEILDERSRIQWQ
WQQLASVVDRLLLCLFCTATLFTIICLLIVPVVYRDNDVLSILNFF
>Q9VVV9 (example of 4 subcellular locations)
MAGNIVKWWKHKILGGYKQFSVQECTTDSEELMYHQVRASSSCSAPPDLLLVSERDNNI
QLRSPVVNIITTPPGNASGAGSKQQSHHQTNHHSSGRSHPGHTAHPQDVSSGGSHSKHL
RISSTSNGKHGKYSNMQQQLPQDEDVVDAAATMQQQQHTGHAHSRHLHHHKEERIRLEE
FTCDVSVEGGKSSQPLQFSFTFYDLDGHHGKITKDDIVGIVYTIYESIGKSVVVPHCGS
KTINVRLTVSPEGKSKSQPVVPVPVAAGFSSSHASKLKKLPTGLAAMSKPLAGGGVGSG
GASALTTSAGNRRQHRYRPRKLIKSDDEDDDSNSEKEKDAAHAPAADQPSGSGTKATGK
SHHHQSQSARYHQKNNSRAEQCCTEQNTPDNGHNTYENMLNLKCCKPEVDQVDCPSHRQ
HHQSHPNHQMRQQDIYMKQATQRVKMLRRARKQKYQDHCLETRQRSLSVGNDSACPNRH
LQLQQPPVGHPQPQSLNHKSASGSPPLGVGGGGDMMLDGVQLRQPRPHSLTPHQHQQQN
QQQQQQQRKSAECWKSALNRNDLISIIRESMEKNRLCFQLNGKPQANVSPIRQPAAQQQ
PQQQQRQRCNTGSKIPTLITNHSPVAQQSPLSCSPPTAEPTTPSIPAAPPAIEVNGQQH
HPTHPTHPSHHNHHEHPQPHIPIYHQQLAINPAVLAAQQTHNTAHNKLNLCGYDSFLHA
TICGGGAAAHSPPATPSNVATVQPIPKKSQKNLLQGYQRLEQSQQQQQQQRSSKDYKNY
GNLIYAKLSEQLQQKDREQRRQRHKQQQHQMLQDQPKDASRSEQRPPTSNSSSAGSKIY
GDAVECAHLLASEEEDLPPSPQLTSTPSKVVSTDTLIDLNDDVGEAVAEAVTEGGKQSL
EAEESGQQVEVELDTSASSSMIHRYVHEHIHHHYHHFKEQQDV
>Q01613 (example of 4 subcellular locations)
MSAFGNTIERWNIKSTGVIAGLGHSERISPVRSMTTLVDSAYSSFSGSSYVPEYQNSFQ
HDGCHYNDEQLSYMDSEYVRAIYNPSLLDKDGVYNDIVSEHGSSKVALSGRSSSSLCSD
NTTSVHRTSPAKLDNYVTNLDSEKNIYGDPINMKHKQNRPNHKAYGLQRNSPTGINSLQ
EKENQLYNPSNFMEIKDNYFGRSLDVLQADGDIMTQDSYTQNALYFPQNQPDQYRNTQY
PGANRMSKEQFKVNDVQKSNEENTERDGPYLTKDGQFVQGQYASDVRTSFKNIRRSLKK
SASGKIVAHDSQGSCWIMKPGKDTPSFNSEGTITDMDYDNREQWDIRKSRLSTRASQSL
YYESNEDVSGPPLKAMNSKNEVDQTLSFQKDATVKSIPLLSQQLQQEKCKSHPLSDLNC
EKITKASTPMLYHLAGGRHSAFIAPVHNTNPAQQEKLKLESKTLERMNNISVLQLSEPR
PDNHKLPKNKSLTQLADLHDSVEGGNSGNLNSSAEESLMNDYIEKLKVAQKKVLRETSF
KRKDLQMSLPCRFKLNPPKRPTIDHFRSYSSSSANEESAYLQTKNSADSSYKKDDTEKV
AVTRIGGRKRITKEQKKLCYSEPEKLDHLGIQKSNFAWKEEPTFANRREMSDSDISANR
IKYLESKERTNSSSNLSKTELKQIQHNALVQYMERKTNQRPNSNPQVQMERTSLGLPNY
NEWSIYSSETSSSDASQKYLRRRSAGASSSYDATVTWNDRFGKTSPLGRSAAEKTAGVQ
RKTFSDQRTLDGSQEHLEGSSPSLSQKTSKSTHNEQVSYVNMEFLPSSHSKNHMYNDRL
TVPGDGTSAESGRMFVSKSRGKSMEEIGTTDIVKLAELSHSSDQLYHIKGPVISSRLEN
TRTTAASHQDRLLASTQIETGNLPRQTHQESVVGPCRSDLANLGQEAHSWPLRASDVSP
GTDNPCSSSPSAEVQPGAPEPLHCLQTEDEVFTPASTARNEEPNSTAFSYLLSTGKPVS
QGEATALSFTFLPEQDRLEHPIVSETTPSSESDENVSDAAAEKETTTTQLPETSNVNKP
LGFTVDNQEVEGDGEPMQPEFIDSSKQLELSSLPSSQVNIMQTAEPYLGDKNIGNEQKT
EDLEQKSKNPEEDDLPKVKLKSPEDEILEELVKEIVAKDKSLLNCLQPVSVRESAMDLM
KSLFPMDVTAAEKSRTRGLLGKDKGETLKKNNSDLESSSKLPSKITGMLQKRPDGESLD
DITLKKMELLSKIGSKLEDLCEQREFLLSDISKNTTNGNNMQTMVKELCKPNEFERYMM
FIGDLEKVVSLLFSLSTRLTRVENSLSKVDENTDAEEMQSLKERHNLLSSQREDAKDLK
ANLDRREQVVTGILVKYLNEEQLQDYKHFVRLKTSLLIEQKNLEEKIKVYEEQFESIHN
SLPP
NOTE:
Each protein sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description.
Close