>AP00020; example for AMP with 3 functional labels
GLFDIVKKIAGHIAGSI
>Q6YKB1; example for non-AMP
MFTNSIKNLIIYLMPLMVTLMLLSVSFVDAGKKPSGPNPGGNN
>AP00176; example for AMP with 5 functional labels
ACYCRIPACIAGERRYGTCIYQGRLWAFCC
>AP00006; example for AMP with 1 functional label
GNNRPVYIPQPRPPHPRI
>AP00004; example for AMP with 2 functional labels
NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC
>AP00725; example for AMP with 4 functional labels
RCICTRGFCRCICTRGFC

NOTE:
Each peptide sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are the sequence ID and only used for the purpose of identification and description.

Close