>Q7TQJ1 (query protein 1; example of 5 subcellular locations)
MLPPPPRQPPPQARTARGSLRLQRAFLRGPLGVLRLLQLLAGAAFWITIATSKYQGPVH
FALFVSVLFWLLTLGLYFITLLGKQELVPVLGSRWLVVNVAHDLLAAALYGAATGIMID
QTQRHSYCNLKNYRLPCAYHAFLAASVCGGLCLGLYLLSALYGCCRRYQGKEEVV
>Q9CZV8 (query protein 2; example of single subcellular location)
MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLA
LDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRN
IEVLSLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNIS
WCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITD
EGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLA
RNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHD
QLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYF
APVTPPPSVGGSRQRFCRCCIIL
>Q9D0P7 (query protein 3; example of 3 subcellular locations)
MEDLKEDIKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRGLAHRSNPNEVAPAL
QGVRFSLGPLSPEKLEEILDEANRLAAQLEECALKDRERAGTGPGRPSPRGKPSPRRET
FVLKDSPVRDLLPTVSSWSTPPPSSLAGLRSSDKKGSARAVRVASGKKPSSIKKESPTC
NLFPASKSPGRSPLAQPILPPRRKTGFGARTTASPPIPVRPVPQSSASNSQCSSRLQGA
AVKSSSRLPVPSAIPKPATRVPLIGRSLPPGKGALAPDSLSTQKGHPSAIGHRASVSQK
TNLPTTSAARGRTTSAARGRAQPLRKAAVPGPTR
NOTE:
Each protein sequence must start with a greater-than symbol (">") in the first column. The words right after the ">" symbol in the single initial line are optional and only used for the purpose of identification and description.
Close