The number of query proteins for each direct submission is limited at 5 or less; select the button (R or K) for predicting Arg- or Lys-methylation site.

>P62805 (example 1)
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

>P68431 (example 2)
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMP
KDIQLARRIRGERA

 

NOTE: The FASTA format for the current predictor can be described as follows.

(1) The first line of each query protein input format must begin with a greater-than (">") symbol in the first column. The word following the ">" symbol is the identifier and description of the sequence, but both are optional.

(2) The sequence (in single-character code) begins in a different line and ends if another line starting with a ">" appears, which indicates the start of another query protein.